GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

vanillotoxin-1   Click here for help

GtoPdb Ligand ID: 5542

Synonyms: tau/kappa-theraphotoxin-Pc1a | tau/kappa-TRTX-Pc1a | VaTx1
Compound class: Peptide
Comment: From the venom of Psalmopoeus cambridgei (Trinidad chevron tarantula)
Click here for help
Peptide Sequence Click here for help
SECRWFMGGCDSTLDCCKHLSCKMGLYYCAWDGTF
Ser-Glu-Cys-Arg-Trp-Phe-Met-Gly-Gly-Cys-Asp-Ser-Thr-Leu-Asp-Cys-Cys-Lys-His-Leu-Ser-Cys-Lys-Met-Gly-Leu-Tyr-Tyr-Cys-Ala-Trp-Asp-Gly-Thr-Phe-NH2
Post-translational Modification
C-terminal phenylalanine is amidated; predicted disulphide bond formation between cysteine residues at positions 3 and 17, 10 and 22, and 16 and 29