GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

β-CGRP   Click here for help

GtoPdb Ligand ID: 682

Synonyms: β-calcitonin gene-related peptide | βCGRP | calcitonin gene-related peptide 2
Species: Human
Click here for help
IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: β-cgrp

Peptide Sequence Click here for help
ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF
Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2
Post-translational Modification
The cysteine residues at positions 2 and 7 form a disulphide bridge and the C-terminal Phenylalanine residue is amidated.