|
Synonyms: Geref® | sermorelin acetate
sermorelin is an approved drug (FDA (1990))
Compound class:
Peptide
Comment: Sermorelin is a synthetically produced 29-amino acid peptide (GRF1-29-NH2) representing the amino-terminal segment of endogenous human growth hormone-releasing hormone. The approved drug is the acetate salt of the amidated peptide. For a representation of the chemical structure of this peptide which does not specify stereochemistry, please see CID 16129620.
|
Peptide Sequence  |
|
| YADAIFTNSYRKVLGQLSARKLLQDIMSRQ | |
| Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln | |
| Chemical Modification | |
| Carboxy terminal amidation | |
