AM-(22-52) (human)

Ligand id: 706

Name: AM-(22-52) (human)

Peptide Sequence
TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY
Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2