GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

GxTx-1E   Click here for help

GtoPdb Ligand ID: 7760

Synonyms: κ-theraphotoxin-Pg1a | κ-TRTX-Pg1a | guangxitoxin-1E
Compound class: Peptide
Comment: GxTX-1E is a 36 amino acid peptide toxin found in the venom of the tarantula Plesiophrictus guangxiensis [1]. It blocks voltage-gated Kv2.1 potassium channel currents [1],
Click here for help
Peptide Sequence Click here for help
EGECGGFWWKCGSGKPACCPKYVCSPKWGLCNFPMP
Glu-Gly-Glu-Cys-Gly-Gly-Phe-Trp-Trp-Lys-Cys-Gly-Ser-Gly-Lys-Pro-Ala-Cys-Cys-Pro-Lys-Tyr-Val-Cys-Ser-Pro-Lys-Trp-Gly-Leu-Cys-Asn-Phe-Pro-Met-Pro
Post-translational Modification
Disulphide bonds between cysteine residues at positions 4 and 19, 11 and 24, and 18 and 31.