GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

sargramostim   Click here for help

GtoPdb Ligand ID: 7905

Synonyms: Leukine®
Approved drug
sargramostim is an approved drug (FDA (1991))
Compound class: Peptide
Comment: Sargramostim is recombinant human GM-CSF, produced in E.coli. Compared to the endogenous peptide sargramostim has a Arg>Leu substitution at residue 23.
Peptide Sequence Click here for help
APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMM
ASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE