CXCL1

Ligand id: 826

Name: CXCL1

Species: Rat

Peptide Sequence
APVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK
Ala-Pro-Val-Ala-Asn-Glu-Leu-Arg-Cys-Gln-Cys-Leu-Gln-Thr-Val-Ala-Gly-Ile-His-Phe-Lys-Asn-Ile-Gln-Ser-Leu-Lys-Val-Met-Pro-Pro-Gly-Pro-His-Cys-Thr-Gln-Thr-Glu-Val-Ile-Ala-Thr-Leu-Lys-Asn-Gly-Arg-Glu-Ala-Cys-Leu-Asp-Pro-Glu-Ala-Pro-Met-Val-Gln-Lys-Ile-Val-Gln-Lys-Met-Leu-Lys-Gly-Val-Pro-Lys