CXCL5   Click here for help

GtoPdb Ligand ID: 829

Synonyms: ENA-78
Immunopharmacology Ligand
Comment: Bioactive CXCL5 is 78 aa in length, cleaved form a 114 aa presursor peptide. It can be N-terminally cleaved by cathepsin G and chymotrypsin to CXCL5-74 and CXCL5-70.
Species: Human
Click here for help
Peptide Sequence Click here for help
AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Ala-Gly-Pro-Ala-Ala-Ala-Val-Leu-Arg-Glu-Leu-Arg-Cys-Val-Cys-Leu-Gln-Thr-Thr-Gln-Gly-Val-His-Pro-Lys-Met-Ile-Ser-Asn-Leu-Gln-Val-Phe-Ala-Ile-Gly-Pro-Gln-Cys-Ser-Lys-Val-Glu-Val-Val-Ala-Ser-Leu-Lys-Asn-Gly-Lys-Glu-Ile-Cys-Leu-Asp-Pro-Glu-Ala-Pro-Phe-Leu-Lys-Lys-Val-Ile-Gln-Lys-Ile-Leu-Asp-Gly-Gly-Asn-Lys-Glu-Asn