GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CXCL7   Click here for help

GtoPdb Ligand ID: 830

Synonyms: PPBP
Immunopharmacology Ligand
Comment: CXCL7 (neutrophil-activating peptide 2, NAP-2) is one of the cleavage products of the pro-platelet basic protein (PPBP) gene. Connective tissue activating protein III and beta-thrombogulin are also products of this gene.
Species: Human
Click here for help
Peptide Sequence Click here for help
SDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Ser-Asp-Leu-Tyr-Ala-Glu-Leu-Arg-Cys-Met-Cys-Ile-Lys-Thr-Thr-Ser-Gly-Ile-His-Pro-Lys-Asn-Ile-Gln-Ser-Leu-Glu-Val-Ile-Gly-Lys-Gly-Thr-His-Cys-Asn-Gln-Val-Glu-Val-Ile-Ala-Thr-Leu-Lys-Asp-Gly-Arg-Lys-Ile-Cys-Leu-Asp-Pro-Asp-Ala-Pro-Arg-Ile-Lys-Lys-Ile-Val-Gln-Lys-Lys-Leu-Ala-Gly-Asp-Glu-Ser-Ala-Asp