CXCL12β   Click here for help

GtoPdb Ligand ID: 845

Synonyms: SDF-1β | stromal cell-derived factor-1 (SDF-1) | stromal cell-derived factor-1β
Immunopharmacology Ligand
Comment: CXCL12-1α and β were the first isoforms of this chemokine identified. Both proteins contain a signal peptide sequence that medaites their secretion via the canonical intracellular secretory pathway. CXCL12 participates in a variety of processes central to homeostasis and physiology, exerting its biological effects by binding to the chemokine receptors CXCR4 and CXCR7.
Species: Human
Click here for help
Peptide Sequence Click here for help
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Lys-Pro-Val-Ser-Leu-Ser-Tyr-Arg-Cys-Pro-Cys-Arg-Phe-Phe-Glu-Ser-His-Val-Ala-Arg-Ala-Asn-Val-Lys-His-Leu-Lys-Ile-Leu-Asn-Thr-Pro-Asn-Cys-Ala-Leu-Gln-Ile-Val-Ala-Arg-Leu-Lys-Asn-Asn-Asn-Arg-Gln-Val-Cys-Ile-Asp-Pro-Lys-Leu-Lys-Trp-Ile-Gln-Glu-Tyr-Leu-Glu-Lys-Ala-Leu-Asn-Lys-Arg-Phe-Lys-Met
Post-translational Modification
Disulphide bond formation between cysteine residues at postions 7 and 32 and 9 and 48