GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

[125I]BH-MIT1   Click here for help

GtoPdb Ligand ID: 8522

 Ligand is labelled  Ligand is radioactive
Compound class: Peptide
Comment: The position of the radiolabelled atom in the amino acid sequence is not specified by the reference.
Click here for help
Peptide Sequence Click here for help
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK
S
Ala-Val-Ile-Thr-Gly-Ala-Cys-Glu-Arg-Asp-Leu-Gln-Cys-Gly-Lys-Gly-Thr-Cys-Cys-Ala-Val-Ser-Leu-Trp-Ile-Lys-Ser-Val-Arg-Val-Cys-Thr-Pro-Val-Gly-Thr-Ser-Gly-Glu-Asp-Cys-His-Pro-Ala-Ser-His-Lys-Ile-Pro-Phe-Ser-Gly-Gln-Arg-Met-His-His-Thr-Cys-Pro-Cys-Ala-Pro-Asn-Leu-Ala-Cys-Val-Gln-Thr-Ser-Pro-Lys-Lys-Phe-Lys-Cys-Leu-Ser-Lys-Ser