GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

galectin 9   Click here for help

GtoPdb Ligand ID: 9594

Synonyms: Ecalectin | Gal-9 | Tumor antigen HOM-HD-21
Immunopharmacology Ligand
Comment: Galectin 9 is a secreted lectin that is an endogenous ligand of the immune co-inhibitory receptor, TIM3. Galectins bind β-galactoside sugar modifications on proteins, and have been associated with metastasis and immunosuppression. Galectin 9 contains two tandem carbohydrate recognition domains (CRD) within its peptide structure. The CRDs are homologous but distinct in their primary sequence. The whole peptide sequence provided here is for the longest isoform reported to date. Uniprot records 6 human protein isoforms [2-3]. Isoform 2 is known as ecalectin, and is reported to be a novel eosinophil chemoattractant produced by T lymphocytes [1,4-5,7]. The regulation and function of galectin 9 in physiological and pathological conditions was reviewed by Hirashima et al. (2004) [6].
Species: Human
Peptide Sequence Click here for help
MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNG
SWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQNPRTVPVQPAFS
TVPFSQPVCFPPRPRGRRQKPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKS
ILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVA
VDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT