GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
|
Synonyms: ZP-1848 | ZP1848
Compound class:
Peptide
Comment: Glepaglutide (ZP1848, Zealand Pharma) is a long-acting human glucagon like peptide-2 (GLP-2) analogue with a C-terminal hexa-lysine addition.
The wild type peptide sequence is HADGSFSDEMNTILDNLAARDFINWLIQTKITD, compared to the glepaglutide sequence which is HGEGTFSSELATILDALAARDFIAWLIATKITDKKKKKK (the hexa-lysine is underlined). GLP-2 receptor agonists have therapeutic potential in clinical indications with compromised absorptive capacity at the intestinal mucosa, such as in short bowel syndrome. GLP-2 analogues have been designed to be less susceptible to enzymatic cleavage and renal clearance and hence have an improved circulating half-life compared to the endogenous peptide. Teduglutide is already approved but has a once-daily injection regimen, so longer-acting analogues are still of development interest. |
|
|||||||||||||||||
For advanced searching click here to open chemical structure editor
Other Similar Sequences ![]() |
|
| GLP-2-(1-29) (rat) |
TargetsGLP-2 receptor |
| glucagon-like peptide 2 {Sp: Human} |
TargetsGLP-2 receptor |
| glucagon-like peptide 2 {Sp: Rat} |
TargetsGLP-2 receptor |
| glucagon-like peptide 2-(2-33) {Sp: Rat} |
TargetsGLP-2 receptor |
| glucagon-like peptide 2-(3-33) {Sp: Human} |
TargetsGLP-2 receptor |
| glucagon-like peptide 2-(3-33) {Sp: Rat} |
TargetsGLP-2 receptor |
| [Tyr34]GLP-2 (human) |
TargetsGLP-2 receptor |
| glucagon-like peptide 2 {Sp: Mouse} |
TargetsGLP-2 receptor |
| glucagon-like peptide 2-(3-33) {Sp: Mouse} |
TargetsGLP-2 receptor |
| teduglutide |
TargetsGLP-2 receptor |
| apraglutide |
TargetsGLP-2 receptor |
| hGLP-2(1-33,M10Y) | |
| hGLP-2(3-33,M10Y) | |