GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

aldafermin   Click here for help

GtoPdb Ligand ID: 11546

Synonyms: M70 | NGM-282 | NGM282
Compound class: Peptide
Comment: Aldafermin (NGM282) is a recombinant, engineered analogue of FGF-19 (FGF19-mimetic) that was developed by NGM Biopharmaceuticals. Acting via the FGFR4-β-Klotho (KLB) receptor complex, aldafermin acts to suppress cholesterol 7α-hydroxylase (CYP7A1), the first and rate-limiting enzyme for bile acids biosynthesis.
Peptide Sequence Click here for help
MRDSSPLVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGAD
GKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESD
MFSSPLETDSMDPFGLVTGLEAVRSPSFEK