|
Synonyms: Natpar® | Natpara® | rhPTH[1-84]
PTH is an approved drug (FDA (2015), EMA (2017))
Compound class:
Endogenous peptide in human, mouse or rat
Comment: In its recombinant form, human parathyroid hormone was approved for clinical use in 2015, under the name Natpara.
The amino acid sequence provided here is the mature peptide, with the signal (MIPAKDMAKVMIVMLAICFLTKSDG) and propeptide (KSVKKR) domains removed.
Species: Human
View more information in the IUPHAR Pharmacology Education Project: pth |
Peptide Sequence  |
|
|
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTK AKSQ |
|
| Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Gly-Ala-Pro-Leu-Ala-Pro-Arg-Asp-Ala-Gly-Ser-Gln-Arg-Pro-Arg-Lys-Lys-Glu-Asp-Asn-Val-Leu-Val-Glu-Ser-His-Glu-Lys-Ser-Leu-Gly-Glu-Ala-Asp-Lys-Ala-Asp-Val-Asn-Val-Leu-Thr-Lys-Ala-Lys-Ser-Gln | |
| Post-translational Modification | |
| None. | |
