PTHrP-(1-21)/PTH-(22-34) (human)   

GtoPdb Ligand ID: 1788

Synonyms: hybrid of human PTHrP and human PTH
Comment: Synthetic hybrid of human PTHrP and PTH 22-34
Peptide Sequence
AVSEHQLLHDKGKSIQDLRRREWLRKKLQDVHNF
Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe