GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

margatoxin   Click here for help

GtoPdb Ligand ID: 2547

Synonyms: MgTx | potassium channel toxin α-KTx 2.2
Compound class: Peptide
Comment: From Centruroides margaritatus (Scorpion)
Click here for help
Peptide Sequence Click here for help
TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH
Thr-Ile-Ile-Asn-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Leu-Pro-Pro-Cys-Lys-Ala-Gln-Phe-Gly-Gln-Ser-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Pro-His
Post-translational Modification
Disulphide bonds between cysteine residues at positions 7 and 29, 13 and 34, and 17 and 36.