GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

M65   Click here for help

GtoPdb Ligand ID: 3305

Synonyms: des-(Gln25-Gln41)-maxadilan | maxadilan Δ25-41
Compound class: Peptide
Comment: The properties of this maxadilan analogue were first described in [2].
Click here for help
Peptide Sequence Click here for help
CDATCQFRKAIDDCQKQAHHSNVLLPGNSVFKECMKQKKKEFKAGK
Cys-Asp-Ala-Thr-Cys-Gln-Phe-Arg-Lys-Ala-Ile-Asp-Asp-Cys-Gln-Lys-Gln-Ala-His-His-Ser-Asn-Val-Leu-Leu-Pro-Gly-Asn-Ser-Val-Phe-Lys-Glu-Cys-Met-Lys-Gln-Lys-Lys-Lys-Glu-Phe-Lys-Ala-Gly-Lys