Synonyms: IbTX
Compound class:
Peptide or derivative
Comment: From the venom gland of Mesobuthus tamulus (Eastern Indian scorpion). Iberiotoxin is selective for KCa1.1 channels that associate with β1, β2 and β3 regulatory subunits [1-3]. In contrast the KCa1.1 channels containing the β4 subunit that are found predominantly in the central nervous system are resistant to iberiotoxin inhibition [6]
|
Peptide Sequence ![]() |
|
XFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ | |
pGlu-Phe-Thr-Asp-Val-Asp-Cys-Ser-Val-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Lys-Asp-Leu-Phe-Gly-Val-Asp-Arg-Gly-Lys-Cys-Met-Gly-Lys-Lys-Cys-Arg-Cys-Tyr-Gln |
Post-translational Modification | |
N-terminal pyrrolidone carboxylic acid formation from glutamine residue (represented by pGlu); disulphide bond formation between cysteine residues at positions 7 and 28, 13 and 33 and 17 and 35 |
Download 2D Structure ![]() |
|
Canonical SMILES | Download |
Isomeric SMILES | Download |
InChI standard identifier | Download |
InChI standard key | Download |
Molecular structure representations generated using Open Babel