iberiotoxin

Ligand id: 4218

Name: iberiotoxin

Structure and Physico-chemical Properties

2D Structure
Peptide Sequence
XFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ
pGlu-Phe-Thr-Asp-Val-Asp-Cys-Ser-Val-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Lys-Asp-Leu-Phe-Gly-Val-Asp-Arg-Gly-Lys-Cys-Met-Gly-Lys-Lys-Cys-Arg-Cys-Tyr-Gln
Post-translational Modification
N-terminal pyrrolidone carboxylic acid formation from glutamine residue (represented by pGlu); disulphide bond formation between cysteine residues at positions 7 and 28, 13 and 33 and 17 and 35
Download 2D Structure
Canonical SMILES Download
Isomeric SMILES Download
InChI standard identifier Download
InChI standard key Download

Molecular structure representations generated using Open Babel