IFN-α2   Click here for help

GtoPdb Ligand ID: 4960

Synonyms: IFN-alpha-2 | interferon alpha-2 | Roferon A®
Approved drug Immunopharmacology Ligand
IFN-α2 is an approved drug (FDA (1989))
Compound class: Endogenous peptide in human, mouse or rat
Comment: IFN-α2 is a type I IFN. The sequence of the recombinant peptide used clinically and known as interferon alfa-2a, is identical to that of human IFN-α2. Interferon alfa-2a has anti-viral, immunomodulatory and antineoplastic actions.
Pegylated IFN alfa 2a is on the World Health Organization's List of Essential Medicines. Click here to access the pdf version of the WHO's 21st Essential Medicines list (2019).
Species: Human
Peptide Sequence Click here for help
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETL
LDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQES
LRSKE
Selected 3D Structures
PDB Id: 1itf
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
O-linked glycosylation of threonine residue at position 106; disulphide bond between cysteine residues at positions 1 and 98, and 29 and 138