GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IFN-α2   Click here for help

GtoPdb Ligand ID: 4960

Synonyms: IFN-alpha-2 | interferon alpha-2 | Roferon A®
Approved drug Immunopharmacology Ligand
IFN-α2 is an approved drug (FDA (1989))
Compound class: Endogenous peptide in human, mouse or rat
Comment: IFN-α2 is a type I IFN. The sequence of the recombinant peptide used clinically and known as interferon alfa-2a, is identical to that of human IFN-α2. Interferon α-2a has anti-viral, immunomodulatory and antineoplastic actions.
Pegylated IFN-α-2a is on the World Health Organization's List of Essential Medicines.
Species: Human
Peptide Sequence Click here for help
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETL
LDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQES
LRSKE
Selected 3D Structures
PDB Id: 1itf
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
O-linked glycosylation of threonine residue at position 106; disulphide bond between cysteine residues at positions 1 and 98, and 29 and 138