Synonyms: IFN-alpha-2 | interferon alpha-2 | Roferon A®
IFN-α2 is an approved drug (FDA (1989))
Compound class:
Endogenous peptide in human, mouse or rat
Comment: IFN-α2 is a type I IFN. The sequence of the recombinant peptide used clinically and known as interferon alfa-2a, is identical to that of human IFN-α2. Interferon alfa-2a has anti-viral, immunomodulatory and antineoplastic actions.
Pegylated IFN alfa 2a is on the World Health Organization's List of Essential Medicines. Click here to access the pdf version of the WHO's 21st Essential Medicines list (2019).
Species: Human
|
Peptide Sequence ![]() |
|
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETL LDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQES LRSKE |
Selected 3D Structures | ||
|
Post-translational Modification | |
O-linked glycosylation of threonine residue at position 106; disulphide bond between cysteine residues at positions 1 and 98, and 29 and 138 |