Synonyms: Actimmune® | immune interferon | interferon gamma
IFN-γ is an approved drug (FDA (1999))
Compound class:
Endogenous peptide in human, mouse or rat
Comment: IFN-γ is a type II interferon. It is biologically active as a homodimer.
Species: Human
View more information in the IUPHAR Pharmacology Education Project: interferon-gamma (ifn-γ) |
Peptide Sequence | |
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVK FFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG |
Selected 3D Structures | ||
|
Post-translational Modification | |
Residue one is pyrrrolidine carboxylic acid; N linked glycosylation of asparagine residue at position 25; N-linked glycosylation of asparagine at position 97 in the dimeric form |