IL-15

Ligand id: 4981

Name: IL-15

Species: Human

Peptide Sequence
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNV
TESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Selected 3D Structures
PDB Id: 2Z3Q
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted N-linked glycosylation of asparagine residue at position 79; predicted disulphide bonds between cysteine residues at positions 35 and 85, and 42 and 88