Compound class:
Endogenous peptide in human, mouse or rat
Comment: IL-5 is one of the hematopoietic family cytokines. Unlike other family members IL-3 and GM-CSF, IL-5 is a homodimer, consisting of two identical amino acid chains linked by two disulphide bonds
Species: Human
|
Peptide Sequence  |
|
|
IPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYID GQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIES |
|
| Selected 3D Structures | ||
|
||
| Post-translational Modification | |
| Il-5 is a homodimer of two amino acid chains. Predicted O linked glycosylation of threonine residue at position 3; predicted N linked glycosylation of asparagine residue at position 28, and two interchain disulphide bonds between residues 44 and 86 of each chain | |
