TGFβ1

Ligand id: 5060

Name: TGFβ1

Species: Human

Peptide Sequence
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVP
QALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Selected 3D Structures
PDB Id: 1kla
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
The active form of the peptide is a disulphide linked homodimer, with the bond between cysteine residues at position 77. Disulphide bonds between cysteine residues at positions 7 and 16, 15 and 78, 44 and 109, and 48 and 111. The sequence provided here is for TGFβ, and represents amino acids 279-390 of the TGFβ1 proprotein.