GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

drotrecogin alfa   Click here for help

GtoPdb Ligand ID: 6788

Synonyms: drotrecogin alfa (activated) | HSDB 7366 | Xigris®
Approved drug
drotrecogin alfa is an approved drug (FDA (2001), EMA (2009))
Compound class: Peptide
Comment: Drotrecogin alfa (activated) is a recombinant form of human activated protein C.
Peptide Sequence Click here for help
LIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNY
SKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHN
ECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRD
KEAPQKSWAP.SKHVDGDQCLVLPLEHPCASLCCGHGTCIXGIGSFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCL
EEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHL
Chemical Modification
This peptide is recombinantly produced activated protein kinase C, consisting of a heavy and a light chain linked by a disilphide bond. In the one letter sequence provided the heavy chain sequence is given first, with the light chain sequnce following the full stop.