GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

adrenomedullin   Click here for help

GtoPdb Ligand ID: 683

Abbreviated name: AM
Immunopharmacology Ligand
Comment: Adrenomedullin is 52 amino acid peptide which is mainly expressed in endothelial and smooth muscle cells. It acts as a vasodilatory peptide and it is known to regulate endothelial barrier function and vascular tone. Evidence from animal models indicates that it is a key player in the development of sepsis-associated hemodynamic and microcirculatory disorders.
Species: Human
Click here for help
Peptide Sequence Click here for help
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY
Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2
Post-translational Modification
The cysteine residues at positions 16 and 21 form a disulphide bridge and the C-terminal tyrosine is amidated.