GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

peginterferon beta-1a   Click here for help

GtoPdb Ligand ID: 7637

Synonyms: interferon beta 1-alpha | PEG-INF-β-1a | Plegridy®
Approved drug Immunopharmacology Ligand
peginterferon beta-1a is an approved drug (EMA and FDA (2014))
Compound class: Peptide
Comment: This drug is a PEGylated version of recombinant human interferon beta-1a [1].
Peptide Sequence Click here for help
MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWN
ETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRL
TGYLRN
Chemical Modification
Recombinant human peptide is covalently linked to a 20 kDa mPEG-OH molecule at the N-terminal α-amino group [1].