GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

apelin receptor early endogenous ligand   Click here for help

GtoPdb Ligand ID: 7930

Abbreviated name: ELA
Synonyms: ELABELA | Ende | tdl | toddler
Comment: ELA signals via the apelin receptor to mediate endoderm differentiation and embryonic heart morphogenesis, and is present prior to the expression of apelin, making this the earliest ligand recognised by the apelin receptor [1]. More recently (Apr 2017) the activity as an endogenous agonist of the Apelin APJ receptor in the adult cardiovascular system was demonstracted [3].
Species: Human
Click here for help
Peptide Sequence Click here for help
QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP
Gln-Arg-Pro-Val-Asn-Leu-Thr-Met-Arg-Arg-Lys-Leu-Arg-Lys-His-Asn-Cys-Leu-Gln-Arg-Arg-Cys-Met-Pro-Leu-His-Ser-Arg-Val-Pro-Phe-Pro
Post-translational Modification
N-linked glycosylation at Asn5 in the peptide sequence shown here (equivalent to Asn27 in the 54 amino acid precursor).