GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CCL20   Click here for help

GtoPdb Ligand ID: 808

Synonyms: LARC | liver and activation-regulated chemokine | macrophage inflammatory protein-3α | MIP-3α
Immunopharmacology Ligand
Comment: CCL20 is a CC family chemokine. It is the only identified ligand for the chemokine receptor CCR6.
Species: Human
Click here for help
Peptide Sequence Click here for help
ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Ala-Ser-Asn-Phe-Asp-Cys-Cys-Leu-Gly-Tyr-Thr-Asp-Arg-Ile-Leu-His-Pro-Lys-Phe-Ile-Val-Gly-Phe-Thr-Arg-Gln-Leu-Ala-Asn-Glu-Gly-Cys-Asp-Ile-Asn-Ala-Ile-Ile-Phe-His-Thr-Lys-Lys-Lys-Leu-Ser-Val-Cys-Ala-Asn-Pro-Lys-Gln-Thr-Trp-Val-Lys-Tyr-Ile-Val-Arg-Leu-Leu-Ser-Lys-Lys-Val-Lys-Asn-Met