CCL19

Ligand id: 810

Name: CCL19

Species: Human

Peptide Sequence
GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Gly-Thr-Asn-Asp-Ala-Glu-Asp-Cys-Cys-Leu-Ser-Val-Thr-Gln-Lys-Pro-Ile-Pro-Gly-Tyr-Ile-Val-Arg-Asn-Phe-His-Tyr-Leu-Leu-Ile-Lys-Asp-Gly-Cys-Arg-Val-Pro-Ala-Val-Val-Phe-Thr-Thr-Leu-Arg-Gly-Arg-Gln-Leu-Cys-Ala-Pro-Pro-Asp-Gln-Pro-Trp-Val-Glu-Arg-Ile-Ile-Gln-Arg-Leu-Gln-Arg-Thr-Ser-Ala-Lys-Met-Lys-Arg-Arg-Ser-Ser