GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CXCL1   Click here for help

GtoPdb Ligand ID: 819

Synonyms: GROα | melanocyte growth-stimulatory activity | MIP-2
Immunopharmacology Ligand
Comment: CXCL1 is a C-X-C motif chemokine expressed by macrophages, neutrophils and epithelial cells, that acts via the chemokine receptor CXCR2. CXCL1 is expressed by keratinocytes and endothelial cells at sites of epithelialization and neovascularization in the process of wound healing [2].
Species: Human
Click here for help
Peptide Sequence Click here for help
ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Ala-Ser-Val-Ala-Thr-Glu-Leu-Arg-Cys-Gln-Cys-Leu-Gln-Thr-Leu-Gln-Gly-Ile-His-Pro-Lys-Asn-Ile-Gln-Ser-Val-Asn-Val-Lys-Ser-Pro-Gly-Pro-His-Cys-Ala-Gln-Thr-Glu-Val-Ile-Ala-Thr-Leu-Lys-Asn-Gly-Arg-Lys-Ala-Cys-Leu-Asn-Pro-Ala-Ser-Pro-Ile-Val-Lys-Lys-Ile-Ile-Glu-Lys-Met-Leu-Asn-Ser-Asp-Lys-Ser-Asn