|
Compound class:
Peptide or derivative
Comment: The p17 protein resides at the amino terminal ends of both the p55gag and p160gag-pol HIV proteins, and is essential for targeting these proteins to the plasma membrane to facilitate the assembly and budding of viral particles. p17 has been reported to bind to the CXCR1 chemokine receptor [1], inducing an IL-8-like cytokine response in monocytes.
Ligand Activity Visualisation ChartsThese are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts. ✖ |
Peptide Sequence  |
|
|
MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYN TVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAADTGHSSQVSQNY |
|
