GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

Dendroaspis natriuretic peptide   Click here for help

GtoPdb Ligand ID: 9070

Abbreviated name: DNP
Compound class: Peptide
Comment: Dendroaspis natriuretic peptide, a snake venom ligand, shares structural similarity to the other known natriuretic peptides, atrial, brain, and C-type natriuretic peptides, in that they all have a 17 amino acid ring structure created by a single disulphide bond [1]. It is natriuretic and diuretic and is a potent activator of cGMP. It causes vasodilation, with beneficial cardiovascular and renal properties in vivo [2].
Click here for help
Peptide Sequence Click here for help
EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA
Glu-Val-Lys-Tyr-Asp-Pro-Cys-Phe-Gly-His-Lys-Ile-Asp-Arg-Ile-Asn-His-Val-Ser-Asn-Leu-Gly-Cys-Pro-Ser-Leu-Arg-Asp-Pro-Arg-Pro-Asn-Ala-Pro-Ser-Thr-Ser-Ala
Post-translational Modification
Disulphide bond C7:C23