Dendroaspis natriuretic peptide   Click here for help

GtoPdb Ligand ID: 9070

Abbreviated name: DNP
Compound class: Peptide or derivative
Comment: Dendroaspis natriuretic peptide, a snake venom ligand, shares structural similarity to the other known natriuretic peptides, atrial, brain, and C-type natriuretic peptides, in that they all have a 17 amino acid ring structure created by a single disulphide bond [1]. It is natriuretic and diuretic and is a potent activator of cGMP. It causes vasodilation, with beneficial cardiovascular and renal properties in vivo [2].
Click here for help

Ligand Activity Visualisation Charts

These are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts.

✖

View interactive charts of activity data across species
Peptide Sequence Click here for help
EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA
Glu-Val-Lys-Tyr-Asp-Pro-Cys-Phe-Gly-His-Lys-Ile-Asp-Arg-Ile-Asn-His-Val-Ser-Asn-Leu-Gly-Cys-Pro-Ser-Leu-Arg-Asp-Pro-Arg-Pro-Asn-Ala-Pro-Ser-Thr-Ser-Ala
Post-translational Modification
Disulphide bond C7:C23