GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

corticotrophin-releasing hormone   Click here for help

GtoPdb Ligand ID: 912

Synonyms: CRF
Species: Human, Mouse, Rat
Click here for help
IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: crh

Peptide Sequence Click here for help
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2
Post-translational Modification
The C-terminal Isoleucine is amidated.