bihelical apoA-I mimetic peptide 5A

Ligand id: 9183

Name: bihelical apoA-I mimetic peptide 5A

Structure and Physico-chemical Properties

2D Structure
Click here for structure editor
Peptide Sequence
DWLKAFYDKVAEKLKEAFPDWAKAAYDKAAEKAKEAA
Asp-Trp-Leu-Lys-Ala-Phe-Tyr-Asp-Lys-Val-Ala-Glu-Lys-Leu-Lys-Glu-Ala-Phe-Pro-Asp-Trp-Ala-Lys-Ala-Ala-Tyr-Asp-Lys-Ala-Ala-Glu-Lys-Ala-Lys-Glu-Ala-Ala
Download 2D Structure
Canonical SMILES Download
Isomeric SMILES Download
InChI standard identifier Download
InChI standard key Download

Molecular structure representations generated using Open Babel