GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

urocortin 3   Click here for help

GtoPdb Ligand ID: 928

Synonyms: JNJ-39588146 | JNJ-9588146 | RT-400 | stresscopin
Comment: Urocortin-3 (stresscopin) is a corticotropin-releasing factor type 2 receptor (CRF2R) agonist. In clinical trial for decompensated heart failure it has demonstrated short-term, dose-dependent efficacy in improving cardiac index and systemic vascular resistance.
Species: Human
Click here for help
Peptide Sequence Click here for help
FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI
Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2
Post-translational Modification
The C-terminal isoleucine is amidated.