GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

efgartigimod alfa   Click here for help

GtoPdb Ligand ID: 9777

Synonyms: ARGX-113 | efgartigimod alfa-fcab | Vyvgart®
Approved drug Immunopharmacology Ligand
efgartigimod alfa is an approved drug (FDA (2021), EMA (2022))
Compound class: Antibody
Comment: Efgartigimod alfa (ARGX-113) is a first-in-class antibody fragment designed for the treatment of patients with severe autoimmune diseases associated with high levels of pathogenic immunoglobulin G (IgG) autoantibodies [6]. It binds to the IgG receptor, major histocompatibility complex class I-like Fc receptor (FcRn, the protein product of the FCGRT gene). Efgartigimod alfa inactivates FcRn's IgG binding ability (the FcRn-IgG interaction normally protects IgG from degradation) thus facilitating accelerated catabolism of native pathogenic autoantibodies [3,5]. The mechanism of this drug action is discussed more comprehensively in Roopenian and Akilesh (2007) [4] and Vaccaro et al. (2005) [7].
Peptide Sequence Click here for help
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLYITREPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY
RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVE
WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALKFHYTQKSLSLSPGK
Chemical Modification
Covalent peptide dimer.