|
Synonyms: platelet factor 4 (PF4)
Compound class:
Endogenous peptide in human, mouse or rat
Comment: CXCL4 is a C-X-C motif chemokine first identified in megakaryocytes and platelets. It is a potent antiangiogenic chemokine and also promotes inflammatory fibrosis [3]. It can be used as a prognostic marker for the fibrosing autoimmune disease systemic sclerosis (scleroderma) [2]. A CXCR3 splice variant, CXCR3B, is a functional receptor for CXCL4 [1].
Species: Human
|
Peptide Sequence  |
|
| EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES | |
| Glu-Ala-Glu-Glu-Asp-Gly-Asp-Leu-Gln-Cys-Leu-Cys-Val-Lys-Thr-Thr-Ser-Gln-Val-Arg-Pro-Arg-His-Ile-Thr-Ser-Leu-Glu-Val-Ile-Lys-Ala-Gly-Pro-His-Cys-Pro-Thr-Ala-Gln-Leu-Ile-Ala-Thr-Leu-Lys-Asn-Gly-Arg-Lys-Ile-Cys-Leu-Asp-Leu-Gln-Ala-Pro-Leu-Tyr-Lys-Lys-Ile-Ile-Lys-Lys-Leu-Leu-Glu-Ser | |
