calcitonin   

GtoPdb Ligand ID: 685

Abbreviated name: CT
Synonyms: LS-173874 | thyrocalcitonin
calcitonin is an approved drug (FDA (1986))
Comment: For an image and identifiers representing the chemical structure of human calcitonin, please see the PubChem entry linked to from this ligand page. The gene encoding human calcitonin also encodes two other isoforms: katacalcin and α-CGRP.
Species: Human
IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: calcitonin

Peptide Sequence
CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP
Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2
Post-translational Modification
The C-terminal proline is amidated into Pro-NH2 and disulphide bridge forms between cysteine residues at positions 1 and 7.