pramlintide   Click here for help

GtoPdb Ligand ID: 7482

Synonyms: AC0137 | Symlin®
Approved drug
pramlintide is an approved drug (FDA (2005))
Compound class: Peptide or derivative
Comment: Pramlintide is an analogue of human amylin, with prolines replacing the native amino acids at positions 25, 28 and 29. The marketed medicine is the acetate salt (PubChem CID 16132446). ChEMBL also represents the acetate form with the record CHEMBL1201669.
Click here for help

Ligand Activity Visualisation Charts

These are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts.

✖

View interactive charts of activity data across species

IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: pramlintide

Peptide Sequence Click here for help
KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY
Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr
Chemical Modification
Carboxy terminal amidated.