connective tissue growth factor

Ligand id: 8927

Name: connective tissue growth factor

Abbreviated name: CTGF

Species: Human

Peptide Sequence
MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGL
FCHFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKC
CEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVR
PCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFI
KTCACHYNCPGDNDIFESLYYRKMYGDMA
Post-translational Modification
Glycosylated at positions 28 and 225. Disulphide bonds predicted between cysteines 256-293, 273-307, 284-323, 287-325 and 292-329.