connective tissue growth factor   Click here for help

GtoPdb Ligand ID: 8927

Abbreviated name: CTGF
Compound class: Endogenous peptide in human, mouse or rat
Comment: CTGF is a multifunctional growth factor secreted by vascular endothelial cells. CTGF is involved in cell migration, proliferation, and differentiation, plays a role chondrogenesis and is involved in the modulation of extracellular matrix deposition and angiogenesis [1-4]. CTGF is expressed at high levels in several types of human malignancies.
CTGF is a clinical molecular target for the identification of therapeutics for the treatment of fibroproliferative diseases.
The signal peptide sequence is MTAASMGPVRVAFVVLLALCSRPAVG (1-26 of the full length amino acid sequence detailed here).
Species: Human
Peptide Sequence Click here for help
MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGL
FCHFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKC
CEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVR
PCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFI
KTCACHYNCPGDNDIFESLYYRKMYGDMA
Post-translational Modification
Glycosylated at positions 28 and 225. Disulphide bonds predicted between cysteines 256-293, 273-307, 284-323, 287-325 and 292-329.