mucosal addressin cell adhesion molecule 1   Click here for help

GtoPdb Ligand ID: 9339

Abbreviated name: MAdCAM-1
Synonyms: addressin | MAdCAM1
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: MAdCAM-1 is an extracellular immunoglobulin-like peptide expressed on endothelial cells of intestinal lymphoid tissue [5,7], where it plays a role in gut immune surveillance. It is the ligand for homing receptors (e.g. α4β7 and α4β1 integrins, and L-selectin) on lymphocytes and it acts to direct leukocytes into mucosal and inflamed tissues. The α4β7/MAdCAM-1 interaction is gut-specific. MAdCAM-1 is being investigated as a drug target with potential for management of inflammatory bowel conditions [1,3,6,9]. It has also been identified as a mechanistic target that regulates gut dysbiosis during immune checkpoint blockade cancer treatment [2,4].

The peptide details we provide are for the α isoform, which forms from the longest and predominant transcript. Soluble MAdCAM-1 can be detected in serum.
Species: Human
Peptide Sequence Click here for help
MDFGLALLLAGLLGLLLGQSLQVKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLGAVQSDTGRSVLT
VRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPDQLTVSPAALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQELEG
AQALGPEVQEEEEEPQGDEDVLFRVTERWRLPPLGTPVPPALYCQATMRLPGLELSHRQAIPVLHSPTSPEPPDTTSPES
PDTTSPESPDTTSQEPPDTTSPEPPDKTSPEPAPQQGSTHTPRSPGSTRTRRPEISQAGPTQGEVIPTGSSKPAGDQLPA
ALWTSSAVLGLLLLALPTYHLWKRCRHLAEDDTHPPASLRLLPQVSAWAGLRGTGQVGISPS
Post-translational Modification
Disulfide bonds: Cys47-Cys 95, Cys 51-Cys98, Cys134-Cys204
Glycosylation: Asn83