GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

anakinra   Click here for help

GtoPdb Ligand ID: 6972

Synonyms: antril | Kineret®
Approved drug Immunopharmacology Ligand
anakinra is an approved drug (FDA (no history prior to 2001), EMA (2002))
Compound class: Peptide
Comment: This drug is a recombinant, nonglycosylated form of the endogenous IL-1 receptor antagonist peptide with an additional methionine at the amino terminus compared to the endogenous peptide.
Click here for help
IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: anakinra

Peptide Sequence Click here for help
MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQ
LEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Met-Arg-Pro-Ser-Gly-Arg-Lys-Ser-Ser-Lys-Met-Gln-Ala-Phe-Arg-Ile-Trp-Asp-Val-Asn-Gln-Lys-Thr-Phe-Tyr-Leu-Arg-Asn-Asn-Gln-Leu-Val-Ala-Gly-Tyr-Leu-Gln-Gly-Pro-Asn-Val-Asn-Leu-Glu-Glu-Lys-Ile-Asp-Val-Val-Pro-Ile-Glu-Pro-His-Ala-Leu-Phe-Leu-Gly-Ile-His-Gly-Gly-Lys-Met-Cys-Leu-Ser-Cys-Val-Lys-Ser-Gly-Asp-Glu-Thr-Arg-Leu-Gln-Leu-Glu-Ala-Val-Asn-Ile-Thr-Asp-Leu-Ser-Glu-Asn-Arg-Lys-Gln-Asp-Lys-Arg-Phe-Ala-Phe-Ile-Arg-Ser-Asp-Ser-Gly-Pro-Thr-Thr-Ser-Phe-Glu-Ser-Ala-Ala-Cys-Pro-Gly-Trp-Phe-Leu-Cys-Thr-Ala-Met-Glu-Ala-Asp-Gln-Pro-Val-Ser-Leu-Thr-Asn-Met-Pro-Asp-Glu-Gly-Val-Met-Val-Thr-Lys-Phe-Tyr-Phe-Gln-Glu-Asp-Glu