GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CXCL8   Click here for help

GtoPdb Ligand ID: 821

Synonyms: interleukin-8
Immunopharmacology Ligand
Comment: The CXCL8 (IL-8) chemokine is upregulated at sites of inflammation where it promotes neutrophil infiltration and activation. It can form homodimers and heterodimers with CXCL4.
Species: Human
Click here for help
Peptide Sequence Click here for help
AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Ala-Val-Leu-Pro-Arg-Ser-Ala-Lys-Glu-Leu-Arg-Cys-Gln-Cys-Ile-Lys-Thr-Tyr-Ser-Lys-Pro-Phe-His-Pro-Lys-Phe-Ile-Lys-Glu-Leu-Arg-Val-Ile-Glu-Ser-Gly-Pro-His-Cys-Ala-Asn-Thr-Glu-Ile-Ile-Val-Lys-Leu-Ser-Asp-Gly-Arg-Glu-Leu-Cys-Leu-Asp-Pro-Lys-Glu-Asn-Trp-Val-Gln-Arg-Val-Val-Glu-Lys-Phe-Leu-Lys-Arg-Ala-Glu-Asn-Ser